SHB Antibody (1M5C5)

Novus Biologicals | Catalog # NBP3-33468

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1M5C5
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 409-509 of human SHB (NP_003019.2).

Sequence:
IWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SHB Antibody (1M5C5)

SHB Antibody (1M5C5)

Western Blot: SHB Antibody (1M5C5) [NBP3-33468] -

Western Blot: SHB Antibody (1M5C5) [NBP3-33468] - Western blot analysis of various lysates, using SHB Rabbit mAb at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for SHB Antibody (1M5C5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SHB

SHB is an adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. It may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. It may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades, and may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Long Name

Src Homology 2 Domain Containing Adaptor Protein B

Alternate Names

bA3J10.2, RP11-3J10.8, SH2 domain-containing adapter protein B, SHB (Src homology 2 domain containing) adaptor protein B, SHB adaptor protein (a Src homology 2 protein), Src homology 2 domain containing adaptor protein B

Gene Symbol

SHB

Additional SHB Products

Product Documents for SHB Antibody (1M5C5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SHB Antibody (1M5C5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SHB Antibody (1M5C5)

There are currently no reviews for this product. Be the first to review SHB Antibody (1M5C5) and earn rewards!

Have you used SHB Antibody (1M5C5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

VEGF - VEGF R2 Signaling Pathways
VEGF - VEGF R2 Signaling Pathway Thumbnail