SLC25A19 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94007

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all SLC25A19 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SLC25A19 (NP_068380.3). MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC25A19 Antibody - Azide and BSA Free

Western Blot: SLC25A19 AntibodyAzide and BSA Free [NBP2-94007]

Western Blot: SLC25A19 AntibodyAzide and BSA Free [NBP2-94007]

Western Blot: SLC25A19 Antibody [NBP2-94007] - Analysis of extracts of HT-29 cells, using SLC25A19 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure ti
Immunocytochemistry/ Immunofluorescence: SLC25A19 Antibody - Azide and BSA Free [NBP2-94007]

Immunocytochemistry/ Immunofluorescence: SLC25A19 Antibody - Azide and BSA Free [NBP2-94007]

Immunocytochemistry/Immunofluorescence: SLC25A19 Antibody [NBP2-94007] - Analysis of NIH/3T3 cells using SLC25A19 at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for SLC25A19 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC25A19

The SLC25A19 gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochon

Alternate Names

DNC, MCPHA, mitochondrial thiamine pyrophosphate carrier, mitochondrial uncoupling protein 1, MUP1, solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19, solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19, TPC

Gene Symbol

SLC25A19

Additional SLC25A19 Products

Product Documents for SLC25A19 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC25A19 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SLC25A19 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SLC25A19 Antibody - Azide and BSA Free and earn rewards!

Have you used SLC25A19 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies