TAF1C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58841

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE

Reactivity Notes

Mouse 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TAF1C Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TAF1C Antibody [NBP2-58841]

Immunocytochemistry/ Immunofluorescence: TAF1C Antibody [NBP2-58841]

Immunocytochemistry/Immunofluorescence: TAF1C Antibody [NBP2-58841] - Staining of human cell line HaCaT shows localization to nucleus & nucleoli fibrillar center.
TAF1C Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TAF1C Antibody - BSA Free [NBP2-58841]

Chromatin Immunoprecipitation-exo-Seq: TAF1C Antibody - BSA Free [NBP2-58841]

ChIP-Exo-Seq composite graph for Anti-TAF1C (NBP2-58841) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TAF1C Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF1C

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-bindingprotein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, bindsto the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatorysignals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have beenidentified. (provided by RefSeq)

Alternate Names

MGC:39976, RNA polymerase I-specific TBP-associated factor 110 kDa, SL1, 110kD subunit, SL1TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD, TAFI110TBP-associated factor 1C, TAFI95, TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa, TATA box-binding protein-associated factor 1C, TATA box-binding protein-associated factor RNA polymerase I subunit C, transcription factor SL1, Transcription initiation factor SL1/TIF-IB subunit C

Gene Symbol

TAF1C

Additional TAF1C Products

Product Documents for TAF1C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF1C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF1C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF1C Antibody - BSA Free and earn rewards!

Have you used TAF1C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...