TAF3B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17176

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TAF3B1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TAF3B1 Antibody [NBP3-17176]

Immunocytochemistry/ Immunofluorescence: TAF3B1 Antibody [NBP3-17176]

Immunocytochemistry/Immunofluorescence: TAF3B1 Antibody [NBP3-17176] - Staining of human cell line K-562 shows localization to nucleoplasm.
TAF3B1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TAF3B1 Antibody - BSA Free [NBP3-17176]

Chromatin Immunoprecipitation-exo-Seq: TAF3B1 Antibody - BSA Free [NBP3-17176]

ChIP-Exo-Seq composite graph for Anti-BDP1 (NBP3-17176) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TAF3B1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF3B1

RNA polymerase (pol) III synthesizes tRNA, 5s rRNA, 7SL RNA and U6 snRNA and is overexpressed in many transformed cell lines and tumors in vivo, since cells must duplicate its protein components before division. Therefore, in order to maintain rapid growth, cells must produce a high level of Pol III transcribed RNA, which requires the presence of the TFIIIB and TFIIIC2 transcription factor complexes. The TFIIIC2 complex is composed of five subunits, TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, that are overexpressed in adenovirus transformed cells as well as in malignant cells in vivo, such as ovarian carcinomas. TFIIIC2 recruits RNA pol III and TFIIIB to promoter elements and may be a key component in the deregulation of malignant cells. The TFIIIB complex includes the TATA-binding protein (TBP), TFIIB-related factor 1 (TFIIIB90, BRF1) and TFIIIB, the expression of which are also upregulated in transformed cells. In many carcinomas, the tumor suppressors retinoblastoma (RB) and p53 are inactivated, which affects their ability to bind and inactivate the function of TFIIIB.

Alternate Names

B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB, DKFZp686K0831, RNA polymerase III, GTF3B subunit 1, TAF3B1, TFIIIB150, TFIIIB90, TFNR, transcription factor-like nuclear regulator

Gene Symbol

BDP1

Additional TAF3B1 Products

Product Documents for TAF3B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF3B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF3B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF3B1 Antibody - BSA Free and earn rewards!

Have you used TAF3B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...