TAF5L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57546

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TAF5L Antibody - BSA Free

Western Blot: TAF5L Antibody [NBP2-57546]

Western Blot: TAF5L Antibody [NBP2-57546]

Western Blot: TAF5L Antibody [NBP2-57546] - Analysis in human placenta tissue.
Immunocytochemistry/ Immunofluorescence: TAF5L Antibody [NBP2-57546]

Immunocytochemistry/ Immunofluorescence: TAF5L Antibody [NBP2-57546]

Immunocytochemistry/Immunofluorescence: TAF5L Antibody [NBP2-57546] - Staining of human cell line U-251 MG shows localization to nuclear speckles. Antibody staining is shown in green.
TAF5L Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TAF5L Antibody - BSA Free [NBP2-57546]

Chromatin Immunoprecipitation-exo-Seq: TAF5L Antibody - BSA Free [NBP2-57546]

ChIP-Exo-Seq composite graph for Anti-TAF5L (NBP2-57546) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TAF5L Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF5L

The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors to facilitate complex assembly and transcription initiation. The encoded protein is structurally similar to one of the histone-like TAFs, TAF5. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Long Name

TAF5-like RNA Polymerase II p300/CBP-associated Factor-associated factor 65 kDa Subunit 5L

Alternate Names

PAF65B

Gene Symbol

TAF5L

Additional TAF5L Products

Product Documents for TAF5L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF5L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF5L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF5L Antibody - BSA Free and earn rewards!

Have you used TAF5L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...