TBX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56667

Novus Biologicals
Discontinued Product
NBP2-56667 has been discontinued. View all TBX1 products.

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TBX1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TBX1 Antibody [NBP2-56667]

Immunocytochemistry/ Immunofluorescence: TBX1 Antibody [NBP2-56667]

Immunocytochemistry/Immunofluorescence: TBX1 Antibody [NBP2-56667] - Staining of human cell line HEK 293 shows localization to nuclear bodies & cytoplasmic bodies. Antibody staining is shown in green.

Applications for TBX1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TBX1

The T-box (TBX) motif is present in a family of genes whose structural features and expression patterns support their involvement in developmental gene regulation. The TBX gene family are largely conserved throughout metazoan evolution, and these genes code for putative transcription factors that share a uniquely defining DNA-binding domain. TBX genes are a family of developmental regulators with more than 20 members recently identified in invertebrates and vertebrates. Mutations in TBX genes are associated with the onset of several human diseases. Our understanding of functional mechanisms of TBX products has come mainly from the prototypical T/Brachyury, which is a transcription activator. The TBX genes constitute a family of transcriptional regulatory genes that are implicated in a variety of developmental processes ranging from the formation of germ layers to the organizational patterning of the central nervous system.

Alternate Names

brachyury, CAFS, CTHM, DGCR, DGS, DORV, T-box 1, T-box 1 transcription factor C, T-box protein 1, T-box transcription factor TBX1, TBX1C, Testis-specific T-box protein, TGA, VCFS

Gene Symbol

TBX1

Additional TBX1 Products

Product Documents for TBX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TBX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TBX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TBX1 Antibody - BSA Free and earn rewards!

Have you used TBX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...