TFEC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57258

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TFEC Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TFEC Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TFEC Antibody [NBP2-57258]

Immunocytochemistry/ Immunofluorescence: TFEC Antibody [NBP2-57258]

Immunocytochemistry/Immunofluorescence: TFEC Antibody [NBP2-57258] - Staining of human cell line CACO-2 shows localization to nucleoplasm.
TFEC Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TFEC Antibody - BSA Free [NBP2-57258]

Chromatin Immunoprecipitation-exo-Seq: TFEC Antibody - BSA Free [NBP2-57258]

ChIP-Exo-Seq composite graph for Anti-TFEC (NBP2-57258) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TFEC Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TFEC

Transcriptional regulator that acts as a repressor or an activator. Acts as a transcriptional repressor on minimal promoter containing element F (that includes an E-box sequence). Binds to element F in an E-box sequence-specific manner. Acts as a transcriptional transactivator on the proximal promoter region of the tartrate-resistant acid phosphatase (TRAP) E-box containing promoter. Collaborates with MITF in target gene activation. Acts as a transcriptional repressor on minimal promoter containing mu E3 enhancer sequence. Binds to mu E3 DNA sequence of the immunoglobulin heavy-chain gene enhancer. Binds DNA in a homo- or heterodimeric form

Alternate Names

Class E basic helix-loop-helix protein 34, hTFEC-L, TCFECTFECLbHLHe34BHLHE34, TFE-C, transcription factor EC, Transcription factor EC-like

Gene Symbol

TFEC

Additional TFEC Products

Product Documents for TFEC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TFEC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TFEC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TFEC Antibody - BSA Free and earn rewards!

Have you used TFEC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies