TIAL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79932

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Zebrafish

Cited:

Fish - Danio rerio (Zebrafish)

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence, In-situ Hybridization

Cited:

Immunocytochemistry/ Immunofluorescence, In Situ Hybridization

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMIDs: 27489304 and 29975683).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TIAL1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932]

Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932]

TIAL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-79932-img0005.jpg
Western Blot: TIAL1 Antibody [NBP1-79932]

Western Blot: TIAL1 Antibody [NBP1-79932]

Western Blot: TIAL1 Antibody [NBP1-79932] - Host: Rabbit. Target: TIAL1. Positive control (+): Mouse Spleen (M-SP). Negative control (-): Mouse Liver (M-LI). Antibody concentration: 2ug/ml
Western Blot: TIAL1 Antibody [NBP1-79932]

Western Blot: TIAL1 Antibody [NBP1-79932]

Western Blot: TIAL1 Antibody [NBP1-79932] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.
TIAL1 Antibody

Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932] -

Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932] - rbpms2 mutant allele stability & localization activity in somatic cells.(A) RT-PCR to detect rbpms2a & rbpms2b maternal transcripts. Pink asterisks indicate likely nonsense mediated decay of mutant allele transcripts. (B-F) Wild-type GFP-Rbpms2a/b (B, D) & GFP-Rbpms2bsa9329 (F) localize to granules in HEK 293 cells, while GFP-Rbpms2aae30 & GFP-Rbpms2bae32 are not localized. (G-K) Zebrafish blastula cells expressing GFP-Rbpms2 fusions. (G,H) Wild-type GFP-Rbpms2b localizes near the nucleus (H), is apparently associated with the centrosome/spindle in some cells, & (G) is in granules that are not positive for the stress granule marker Tial-1. (H) A subset of GFP-Rbpms2b positive granules are positive for the p-body marker Dcp2 (open arrowheads). (I) GFP-Rbpms2bsa9329 localization to the centrosome/spindle but not granules. (J) GFP-Rbpms2bae32 & (K) GFP-Rbpms2aae30 localization. Insets show magnified views of the highlighted cells. Images are representative slices from Z-stacks of sphere stage embryos viewed from the animal pole. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29975683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TIAL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 29975683). Use in In-situ Hybridization reported in scientific literature (PMID: 27489304).

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIAL1

TIAL1 is encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing.

Alternate Names

aging-associated gene 7 protein, MGC33401, TCBP, T-cluster binding protein, TIA1 cytotoxic granule-associated RNA binding protein-like 1, TIA1 cytotoxic granule-associated RNA-binding protein-like 1, TIA-1 related protein, TIA-1-related nucleolysin, TIA-1-related protein, TIARnucleolysin TIAR

Gene Symbol

TIAL1

Additional TIAL1 Products

Product Documents for TIAL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIAL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TIAL1 Antibody - BSA Free

Customer Reviews for TIAL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIAL1 Antibody - BSA Free and earn rewards!

Have you used TIAL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...