UACA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58742

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UACA Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTLNDTLAKTNRELLDVKKKFEDINQEFVKIKDKNEILKRNLENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEIVTLHAEIKAQKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UACA Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: UACA Antibody [NBP2-58742]

Immunocytochemistry/ Immunofluorescence: UACA Antibody [NBP2-58742]

Immunocytochemistry/Immunofluorescence: UACA Antibody [NBP2-58742] - Staining of human cell line RH-30 shows localization to nucleus & cytosol.

Applications for UACA Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UACA

UACA (uveal autoantigen with coiled-coil domains and ankyrin repeats) was originally identified as an autoantigen in patients with panuveitis, a characteristic of Vogt-Koyanagi-Harada disease, and in patients with Graves' disease. UACA was also later identified as Nucling, an mRNA differentially expressed in F9 embryonal carcinoma cells during cardiac muscle differentiation. UACA appears to function as a pro-apoptotic protein that recruits the apaf-1-pro-caspase-9 complex for the induction of apoptosis to mediate the cell-death pathway.

Alternate Names

FLJ10128, KIAA1561MGC141969, MGC141967, nuclear membrane binding protein, NUCLING, uveal autoantigen with coiled coil domains and ankyrin repeats, uveal autoantigen with coiled-coil domains and ankyrin repeats

Gene Symbol

UACA

Additional UACA Products

Product Documents for UACA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UACA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UACA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UACA Antibody - BSA Free and earn rewards!

Have you used UACA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies