WBP11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58142

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WBP11 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WBP11 Antibody - BSA Free

Western Blot: WBP11 Antibody [NBP2-58142]

Western Blot: WBP11 Antibody [NBP2-58142]

Western Blot: WBP11 Antibody [NBP2-58142] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: WBP11 Antibody [NBP2-58142]

Immunocytochemistry/ Immunofluorescence: WBP11 Antibody [NBP2-58142]

Immunocytochemistry/Immunofluorescence: WBP11 Antibody [NBP2-58142] - Staining of human cell line RH-30 shows localization to nucleoplasm.

Applications for WBP11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WBP11

WBP11 encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus. [provided by RefSeq]

Alternate Names

DKFZp779M1063, Npw38-binding protein, Npw38-binding protein NpwBP, NpwBP, NPWBPsplicing factor, PQBP1 and PP1 interacting, SH3 domain-binding protein SNP70, SIPP1WW domain-binding protein 11, SNP70, Splicing factor that interacts with PQBP-1 and PP1, WBP-11, WW domain binding protein 11

Gene Symbol

WBP11

Additional WBP11 Products

Product Documents for WBP11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WBP11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WBP11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WBP11 Antibody - BSA Free and earn rewards!

Have you used WBP11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies