WW domain binding protein 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25333

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein WW domain binding protein 5 using the following amino acid sequence: EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WW domain binding protein 5 Antibody - BSA Free

WW domain binding protein 5 Antibody Immunocytochemistry/Immunofluorescence: WW domain binding protein 5 Antibody [NBP3-25333]

Immunocytochemistry/Immunofluorescence: WW domain binding protein 5 Antibody [NBP3-25333]

Staining of human cell line GAMG shows localization to nucleoli.

Applications for WW domain binding protein 5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WW domain binding protein 5

The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 through 4 encode the same isoform.

Alternate Names

DKFZp313K1940, N4, NDFIP1, pp21 homolog, TCEAL9, WBP-5, WW domain binding protein 1, WW domain binding protein 5, WW domain-binding protein 5

Gene Symbol

TCEAL9

Additional WW domain binding protein 5 Products

Product Documents for WW domain binding protein 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WW domain binding protein 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WW domain binding protein 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WW domain binding protein 5 Antibody - BSA Free and earn rewards!

Have you used WW domain binding protein 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...