XPF Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58407

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all XPF Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for XPF Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: XPF Antibody [NBP2-58407]

Immunocytochemistry/ Immunofluorescence: XPF Antibody [NBP2-58407]

Immunocytochemistry/Immunofluorescence: XPF Antibody [NBP2-58407] - Staining of human cell line A-431 shows localization to nucleoplasm & cell junctions.
XPF Antibody

Western Blot: XPF Antibody [NBP2-58407] -

Western Blot: XPF Antibody [NBP2-58407] -Analysis in human cell line EFO-21.

Applications for XPF Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: XPF

XPF/ERCC4 is suggested to play a role in the repair of DNA double-strand breaks (DSB), homologous recombination, and gene conversion via single-strand annealing (SSA). XPF/ERCC4 is an endonuclease that incises 5-prime DNA. Defects in XPF/ERCC4 cause xeroderma pigmentosum VI (XP6) an autosomal recessive disease characterized by hypersensitivity to sunlight and a predisposition to skin cancer as well as neurological abnormalities. Defects in XPF/ERCC4 are also responsible for XFE progeroid syndrome, a syndrome characterized by dwarfism, cachexia, and microcephaly.

Long Name

Xeroderma Pigmentosum F

Alternate Names

ERCC4

Gene Symbol

ERCC4

Additional XPF Products

Product Documents for XPF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for XPF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for XPF Antibody - BSA Free

Customer Reviews for XPF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review XPF Antibody - BSA Free and earn rewards!

Have you used XPF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies