XRCC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56545

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all XRCC3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDV

Reactivity Notes

Mouse 85%, Rat 84%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for XRCC3 Antibody - BSA Free

Western Blot: XRCC3 Antibody [NBP2-56545]

Western Blot: XRCC3 Antibody [NBP2-56545]

Western Blot: XRCC3 Antibody [NBP2-56545] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: XRCC3 Antibody [NBP2-56545]

Immunocytochemistry/ Immunofluorescence: XRCC3 Antibody [NBP2-56545]

Immunocytochemistry/Immunofluorescence: XRCC3 Antibody [NBP2-56545] - Staining of human cell line RH-30 shows localization to nucleoplasm & cytosol.

Applications for XRCC3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: XRCC3

XRCC3, also known as DNA repair protein XRCC3, X-ray repair cross-complementing protein 3, and CMM6, belongs to the RecA family and the RAD51 subfamily. XRCC3 plays a role in the homologous recombination repair (HRR) pathway of double-stranded DNA. The pathway is responsible for repairing chromosomal fragmentation, translocations, and deletions. Additionally, XRCC3 is also involved in regulating the mitochondrial DNA copy number in the presence of oxidative stress in the presence of RAD51 and RAD51C. XRCC3 is a functional compliment to Chinese hamster irs1SF. Rare microsatellite polymorphisms in the XRCC3 gene have been associated with cancer in patients with radiosensitivity. Defects of the XRCC3 gene have also been linked to breast cancer and cutaneous malignant melanoma type 6 (CMM6).

Alternate Names

CMM6, DNA repair protein XRCC3, X-ray repair complementing defective repair in Chinese hamster cells 3, X-ray repair cross-complementing protein 3

Gene Symbol

XRCC3

Additional XRCC3 Products

Product Documents for XRCC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for XRCC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for XRCC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review XRCC3 Antibody - BSA Free and earn rewards!

Have you used XRCC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies