ZFYVE9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57521

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN

Reactivity Notes

Mouse 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZFYVE9 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZFYVE9 Antibody [NBP2-57521]

Immunocytochemistry/ Immunofluorescence: ZFYVE9 Antibody [NBP2-57521]

Immunocytochemistry/Immunofluorescence: ZFYVE9 Antibody [NBP2-57521] - Staining of human cell line RT4 shows localization to cytosol & vesicles.

Applications for ZFYVE9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZFYVE9

ZFYVE9 encodes a double zinc finger (FYVE domain) protein that interacts directly with SMAD2 and SMAD3, and is involved in Alzheimer's disease. SMAD proteins transmit signals from transmembrane serine/threonine kinase receptors to the nucleus. The FYVE domain has been identified in a number of unrelated signaling molecules. This protein functions to recruit SMAD2 to the transforming growth factor-beta receptor. The FYVE domain is required to maintain the normal localization of this protein but is not involved in mediating interaction with SMADs. The C-terminal domain of this protein interacts with the TGFB receptor. This protein is a component of the TGFB pathway that brings the SMAD substrate to the receptor. Three alternatively spliced transcripts encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

Madh-interacting protein, MADHIP, mothers against decapentaplegic homolog interacting protein, mothers against decapentaplegic homolog interacting protein, receptoractivation anchor, NSP, receptor activation anchor, SARAhSARA, Smad anchor for receptor activation, SMADIPMAD, mothers against decapentaplegic homolog (Drosophila) interacting protein, zinc finger FYVE domain-containing protein 9, zinc finger, FYVE domain containing 9

Gene Symbol

ZFYVE9

Additional ZFYVE9 Products

Product Documents for ZFYVE9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZFYVE9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZFYVE9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZFYVE9 Antibody - BSA Free and earn rewards!

Have you used ZFYVE9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...