ZNF230 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58880

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZNF230 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GKTIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPSQNGKCKQSFSDVAIFDPPQQFHSGEKS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF230 Antibody - BSA Free

Western Blot: ZNF230 Antibody [NBP2-58880]

Western Blot: ZNF230 Antibody [NBP2-58880]

Western Blot: ZNF230 Antibody [NBP2-58880] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ZNF230 Antibody [NBP2-58880]

Immunocytochemistry/ Immunofluorescence: ZNF230 Antibody [NBP2-58880]

Immunocytochemistry/Immunofluorescence: ZNF230 Antibody [NBP2-58880] - Staining of human cell line SiHa shows localization to mitochondria.
Western Blot: ZNF230 Antibody [NBP2-58880]

Western Blot: ZNF230 Antibody [NBP2-58880]

Western Blot: ZNF230 Antibody [NBP2-58880] - Analysis in human cell line THP-1.

Applications for ZNF230 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF230

ZNF230 is encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis.

Alternate Names

FLJ12515, FLJ14855, zinc finger protein 502

Gene Symbol

ZNF230

Additional ZNF230 Products

Product Documents for ZNF230 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNF230 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF230 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF230 Antibody - BSA Free and earn rewards!

Have you used ZNF230 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies