14-3-3 zeta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92614

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all 14-3-3 zeta Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 146-245 of human 14-3-3 zeta (NP_001129171.1). QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 zeta Antibody - BSA Free

14-3-3 zeta Antibody - BSA Free

Western Blot: 14-3-3 zeta Antibody - BSA Free [NBP2-92614] -

Western Blot: 14-3-3 zeta Antibody - BSA Free [NBP2-92614] - Western blot analysis of various lysates using 14-3-3 zeta Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for 14-3-3 zeta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 14-3-3 zeta

14-3-3 zeta is a protein that mediates signal transduction by binding to phosphoserine-containing proteins. The protein is widely expressed in various gray matter regions of the brain. Overexpression of the 14-3-3 zeta gene has been found to correlate with chemoresistance to anthracyclines and metastatis recurrence of human breast cancer. These effects are likely caused by an anti-apoptotic mechanism of 14-3-3 zeta during anthracycline treatment.

Alternate Names

1433 zeta, KCIP-1, YWHAZ

Gene Symbol

YWHAZ

Additional 14-3-3 zeta Products

Product Documents for 14-3-3 zeta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 14-3-3 zeta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 14-3-3 zeta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 14-3-3 zeta Antibody - BSA Free and earn rewards!

Have you used 14-3-3 zeta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies