4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-56432PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 4-1BB/TNFRSF9/CD137.

Source: E. coli

Amino Acid Sequence: KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56432.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-56432PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: 4-1BB/TNFRSF9/CD137

4-1BB, also called CD137 and tumor necrosis factor receptor superfamily member 9 (TNFRSF9), is a type I surface glycoprotein expressed on activated T cell and natural killer (NK) cells (1,2). Human 4-1BB protein is 255 amino acids (aa) in length with a theoretical molecular weight of 28 kDa. It contains an extracellular domain, a helical transmembrane domain, and a cytoplasmic/intracellular domain (3). 4-1BB/TNFRSF9/CD137 is a costimulatory receptor that binds the ligand 4-1BBL/CD137L which is primarily expressed on antigen presenting cells (APCs) such as dendritic cells (DCs), macrophages, and B cells (1,2,4,5). The 4-1BB receptor-ligand interaction results in recruitment of TNFR-associated factor (TRAF) family adaptor proteins to 4-1BB's cytoplasmic domain (1,2,4,5). TRAF1, TRAF2, and TRAF3 are found in various homodimer and/or heterodimer configurations. Their recruitment to 4-1BB/CD137 initiates signalosome formation as well as activation of the nuclear factor-kappa B (NF-kappaB) and mitogen-activated protein kinase (MAPK) signaling cascade (1,4,5). 4-1BB/TNFRSF9/CD137 stimulation leads to increased cellular cytotoxic activity and pro-inflammatory cytokine production (1,2,4). Given its role in immune cell activation, 4-1BB has become a promising target for cancer immunotherapy (1,2,4). Current approaches to target 4-1BB include agonistic monoclonal and bispecific anti-4-1BB antibodies and well as utilizing the cytoplasmic domain of 4-1BB in generating chimeric antigen receptors (CARs) (1,2,4). 4-1BB agonists in clinical trials include Urelumab and Utolimumab. Utolimumab also has ligand blocking properties whereas Urelumab does not (1,2,4). Anti-4-1BB monoclonal antibodies are being tested as monotherapy as well as combination therapy with either other immunostimulatory monoclonal antibodies or with checkpoint blockade antibodies like anti-PD-1 (1,2,4).

References

1. Etxeberria, I., Glez-Vaz, J., Teijeira, A., & Melero, I. (2020). New emerging targets in cancer immunotherapy: CD137/4-1BB costimulatory axis. ESMO open, 4(Suppl 3), e000733. https://doi.org/10.1136/esmoopen-2020-000733

2. Chester, C., Sanmamed, M. F., Wang, J., & Melero, I. (2018). Immunotherapy targeting 4-1BB: mechanistic rationale, clinical results, and future strategies. Blood, 131(1), 49-57. https://doi.org/10.1182/blood-2017-06-741041

3. Uniport (Q07011)

4. Chester, C., Ambulkar, S., & Kohrt, H. E. (2016). 4-1BB agonism: adding the accelerator to cancer immunotherapy. Cancer Immunology, Immunotherapy: CII, 65(10), 1243-1248. https://doi.org/10.1007/s00262-016-1829-2

5. Zapata, J. M., Perez-Chacon, G., Carr-Baena, P., Martinez-Forero, I., Azpilikueta, A., Otano, I., & Melero, I. (2018). CD137 (4-1BB) signalosome: complexity is a matter of TRAFs. Frontiers in Immunology, 9, 2618. https://doi.org/10.3389/fimmu.2018.02618

Alternate Names

41BB, CD137, ILA, TNFRSF9

Gene Symbol

TNFRSF9

Additional 4-1BB/TNFRSF9/CD137 Products

Product Documents for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen and earn rewards!

Have you used 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes