5-HT1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86927

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all 5-HT1B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human 5-HT1B. Peptide sequence: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for 5-HT1B Antibody - BSA Free

Western Blot: 5-HT1B Antibody [NBP2-86927]

Western Blot: 5-HT1B Antibody [NBP2-86927]

Western Blot: 5-HT1B Antibody [NBP2-86927] - WB Suggested Anti-HTR1B Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate

Applications for 5-HT1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 5-HT1B

5HT1B Receptor is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.

Long Name

5-Hydroxytryptamine Receptor 1B

Alternate Names

5HT1B, 5HT1DB, HTR1B, HTR1D2, HTR1DB, S12, Serotonin 1D beta receptor, Serotonin receptor 1B

Gene Symbol

HTR1B

Additional 5-HT1B Products

Product Documents for 5-HT1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 5-HT1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 5-HT1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 5-HT1B Antibody - BSA Free and earn rewards!

Have you used 5-HT1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies