ABCA10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82544

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ABCA10 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ABCA10. Peptide sequence: HEIFENEINPEHSSDDSFEPVSPEFHGKEAIRIRNVIKEYNGKTGKVEAL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ABCA10 Antibody - BSA Free

Western Blot: ABCA10 Antibody [NBP2-82544]

Western Blot: ABCA10 Antibody [NBP2-82544]

Western Blot: ABCA10 Antibody [NBP2-82544] - Host: Rabbit. Target Name: ABCA10. Sample Tissue: Human Esophagus Tumor lysates. Antibody Dilution: 1ug/ml

Applications for ABCA10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCA10

"The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate

Alternate Names

ATP-binding cassette A10, ATP-binding cassette sub-family A member 10, ATP-binding cassette, sub-family A (ABC1), member 10, EC 3.6.3, EC 3.6.3.41, EST698739

Gene Symbol

ABCA10

Additional ABCA10 Products

Product Documents for ABCA10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ABCA10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABCA10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABCA10 Antibody - BSA Free and earn rewards!

Have you used ABCA10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies