ABCB7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84373

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ABCB7. Peptide sequence: ADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit ABCB7 Antibody - BSA Free (NBP2-84373) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ABCB7 Antibody - BSA Free

Western Blot: ABCB7 Antibody [NBP2-84373]

Western Blot: ABCB7 Antibody [NBP2-84373]

Western Blot: ABCB7 Antibody [NBP2-84373] - Host: Rabbit. Target Name: ABCB7. Sample Type: Hela Whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for ABCB7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCB7

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC)transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes aredivided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of theMDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigenpresentation. This gene encodes a half-transporter involved in the transport of heme from the mitochondria to thecytosol. With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis.Mutations in this gene have been implicated in X-linked sideroblastic anemia with ataxia. (provided by RefSeq)

Alternate Names

ABC transporter 7 protein, ABC7ATP-binding cassette sub-family B member 7, mitochondrial, ASATATP-binding cassette 7, Atm1p, ATP-binding cassette transporter 7, ATP-binding cassette, sub-family B (MDR/TAP), member 7, EC 3.6.3, EC 3.6.3.42, EST140535

Gene Symbol

ABCB7

Additional ABCB7 Products

Product Documents for ABCB7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ABCB7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABCB7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABCB7 Antibody - BSA Free and earn rewards!

Have you used ABCB7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...