ABCE1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58061

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (99%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ABCE1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCE1 Antibody - BSA Free

Western Blot: ABCE1 Antibody [NBP2-58061]

Western Blot: ABCE1 Antibody [NBP2-58061]

Western Blot: ABCE1 Antibody [NBP2-58061] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ABCE1 Antibody [NBP2-58061]

Immunocytochemistry/ Immunofluorescence: ABCE1 Antibody [NBP2-58061]

Immunocytochemistry/Immunofluorescence: ABCE1 Antibody [NBP2-58061] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Applications for ABCE1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCE1

ATP-binding cassette sub-family E member 1 (ABCE1) is a member of the ATP-binding cassette sub-family E, but is not a membrane transporter.

ABCE-1 interacts with RNASEL to inhibit its endoribonuclease activity, and antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. ABCE1 is activated by encephalomyocarditis virus (EMCV) and HIV-1, and recently it has been found to be essential for the assembly of immature immunodeficiency virus capsids.

ABCE1 antibodies are useful tools for HIV studies and research on the ATP-binding cassette families.

Alternate Names

2'-5'-oligoadenylate-binding protein, ATP-binding cassette, sub-family E (OABP), member 1, HuHP68, OABP, Ribonuclease 4 inhibitor, ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent) inhibitor, RLIABC38, RNase L inhibitor, RNASEL1, RNASELIRNS4IATP-binding cassette sub-family E member 1

Gene Symbol

ABCE1

Additional ABCE1 Products

Product Documents for ABCE1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ABCE1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABCE1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABCE1 Antibody - BSA Free and earn rewards!

Have you used ABCE1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies