ABHD4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84378

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ABHD4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat ABHD4. Peptide sequence: DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ABHD4 Antibody - BSA Free

Western Blot: ABHD4 Antibody [NBP2-84378]

Western Blot: ABHD4 Antibody [NBP2-84378]

Western Blot: ABHD4 Antibody [NBP2-84378] - Host: Rabbit. Target Name: Abhd4. Sample Type: Rat Pancreas lysates. Antibody Dilution: 1.0ug/ml

Applications for ABHD4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABHD4

Lysophospholipase selective for N-acyl phosphatidylethanolamine (NAPE). Contributes to the biosynthesis ofN-acyl ethanolamines, including the endocannabinoid anandamide by hydrolyzing the sn-1 and sn-2 acyl chains fromN-acyl phosphatidylethanolamine (NAPE) generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate forN-acyl ethanolamine biosynthesis. Hydrolyzes substrates bearing saturated, monounsaturated, polyunsaturated N-acylchains. Shows no significant activity towards other lysophospholipids, including lysophosphatidylcholine,lysophosphatidylethanolamine and lysophosphatidylserine

Alternate Names

ABH4, abhydrolase domain containing 4, abhydrolase domain-containing protein 4, Alpha/beta-hydrolase 4, EC 3.1.1.-, FLJ12816, Lyso-N-acylphosphatidylethanolamine lipase

Gene Symbol

ABHD4

Additional ABHD4 Products

Product Documents for ABHD4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ABHD4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABHD4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABHD4 Antibody - BSA Free and earn rewards!

Have you used ABHD4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies