ABI3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82553

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ABI3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Abi3. Peptide sequence: DEPSWVPASYLEKVVTLYPYTRQKDNELSFSEGTVICVTRRYSDGWCEGV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ABI3 Antibody - BSA Free

Western Blot: ABI3 Antibody [NBP2-82553]

Western Blot: ABI3 Antibody [NBP2-82553]

Western Blot: ABI3 Antibody [NBP2-82553] - Host: Rabbit. Target Name: Abi3. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

Applications for ABI3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABI3

The ABI3 gene encodes a member of an adaptor protein family. Members of this family encode proteins containing a homeobox homology domain, proline rich region and Src-homology 3 (SH3) domain. The encoded protein inhibits ectopic metastasis of tumor cells as w

Alternate Names

ABI family, member 3, ABI gene family member 3, Nesh, NESHABI gene family, member 3, New molecule including SH3, SSH3BP3

Gene Symbol

ABI3

Additional ABI3 Products

Product Documents for ABI3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ABI3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABI3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABI3 Antibody - BSA Free and earn rewards!

Have you used ABI3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies