ACCN4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17796

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GLLAREGQGREALASPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACCN4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ACCN4 Antibody [NBP3-17796]

Immunocytochemistry/ Immunofluorescence: ACCN4 Antibody [NBP3-17796]

Immunocytochemistry/Immunofluorescence: ACCN4 Antibody [NBP3-17796] - Staining of human cell line HEL shows localization to nucleoplasm, plasma membrane & centriolar satellites.

Applications for ACCN4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACCN4

ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder. FUNCTION: Probable cation channel with high affinity for sodium. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. SUBUNIT: Homotetramer or heterotetramer with other ASIC proteins (Probable). SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: This gene is predominantly expressed in the pituitary gland. Expressed in brain, spinal chord and dorsal root ganglion (DRG). Expressed by a subset of sensory neurons in the DRG. Expressed by granule cells in the cerebellar cortex. In hippocampus, expression is detected in dentate gyrus granule cells, in pyramidal cells of CA1-CA3 subfields and in interneurons of the striatum oriens and radiatum of all subfields. In cerebral cortex expressed in small, medium and large pyramidal cells in layers 2, 3 and 5 respectively. Also expressed in striatum, globus pallidus, inferior and superior calliculi, amygdala, magnocellular preoptic nucleus, islands of Calleja and large neurons of olfactory tubercules. DEVELOPMENTAL STAGE: Highly expressed in newborn spinal chord but hardly detected in the cerebellum compared to adult. Expressed at postnatal day 1 in ependymal cells lining the central canal of spinal chord and in motor neurons. In adult, expression decreases in ependymal cells and increases in motor neurons. The number of positive interneurons decreases but the individual interneuron expression increases in adult spinal chord compared to newborn. MISCELLANEOUS: In vitro, has no proton-gated channel activity.

Alternate Names

Acid-sensing ion channel 4, amiloride-sensitive cation channel 4, pituitaryMGC17248, ASIC4MGC24860, BNAC4amiloride-sensitive cation channel 4, brain sodium channel 4

Gene Symbol

ASIC4

Additional ACCN4 Products

Product Documents for ACCN4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACCN4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACCN4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACCN4 Antibody - BSA Free and earn rewards!

Have you used ACCN4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...