ACF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10958

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACF1 (NP_038476). Peptide sequence SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

179 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ACF1 Antibody - BSA Free

Western Blot: ACF1 Antibody [NBP3-10958]

Western Blot: ACF1 Antibody [NBP3-10958]

Western Blot: ACF1 Antibody [NBP3-10958] - Western blot analysis using NBP3-10958 on Human Stomach as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for ACF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACF1

ACF1/BAZ1A is a subunit of the ACF chromatin-remodeling complex and the ISWI CHRAC remodeling complex. In the ACF complex, ACF1/BAZ1A functions to influence the nucleosome remodeling activity of the SNF2h ATPase. As part of the CHRAC complex, ACF1/BAZ1A may function to target CHRAC to heterochromatin. ACF1 has also been shown to interact with the nuclear receptor corepressor protein (N-CoR) to facilitate the repression of transcription by unliganded nuclear receptors. Alternate names for ACF1/BAZ1A include ATP-utilizing chromatin assembly and remodeling factor1, hACF1, bromodomain adjacent to zinc finger domain protein 1A, Williams syndrome transcription factor-related chromatin-remodeling factor 180, WCRF180, hWALp1, and CHRAC subunit ACF1.

Alternate Names

ACF1hWALp1, ATP-dependent chromatin remodeling protein, ATP-dependent chromatin-remodeling protein, ATP-utilizing chromatin assembly and remodeling factor 1, bromodomain adjacent to zinc finger domain protein 1A, bromodomain adjacent to zinc finger domain, 1A, CHRAC subunit ACF1, hACF1FLJ14383, WALp1, WCRF180DKFZp586E0518, Williams syndrome transcription factor-related chromatin-remodeling factor 180

Gene Symbol

BAZ1A

Additional ACF1 Products

Product Documents for ACF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACF1 Antibody - BSA Free and earn rewards!

Have you used ACF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...