ACOT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70402

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACOT2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ACOT2(acyl-CoA thioesterase 2) The peptide sequence was selected form the middle region of ACOT2 (NP_006812). Peptide sequence SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACOT2 Antibody - BSA Free

Western Blot: ACOT2 Antibody [NBP1-70402]

Western Blot: ACOT2 Antibody [NBP1-70402]

Western Blot: ACOT2 Antibody [NBP1-70402] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: ACOT2 Antibody [NBP1-70402]

Western Blot: ACOT2 Antibody [NBP1-70402]

Western Blot: ACOT2 Antibody [NBP1-70402] - Human Fetal Liver.

Applications for ACOT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOT2

Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA (Hunt et al., 2005 [PubMed 16103133]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 CR610624.1 1-7 8-1155 BC006335.2 1-1148 1156-1767 L40401.1 468-1079

Alternate Names

acyl-CoA thioesterase 2MTE1, Acyl-coenzyme A thioester hydrolase 2a, acyl-coenzyme A thioesterase 2, mitochondrial, CTE-Ia, EC 3.1.2.2, Long-chain acyl-CoA thioesterase 2, mitochondrial acyl-CoA thioesterase 1, mitochondrial acyl-CoA thioesterase 2, peroxisomal long-chain acyl-coA thioesterase 2, PTE2A, PTE2CTE1A, ZAP128Mte1

Entrez Gene IDs

10965 (Human)

Gene Symbol

ACOT2

UniProt

P49753 (Human)

Additional ACOT2 Products

Product Documents for ACOT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACOT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACOT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACOT2 Antibody - BSA Free and earn rewards!

Have you used ACOT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies