Acrosin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84388

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Acrosin Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Acrosin. Peptide sequence: GKIDTCQGDSGGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Acrosin Antibody - BSA Free

Western Blot: Acrosin Antibody [NBP2-84388]

Western Blot: Acrosin Antibody [NBP2-84388]

Western Blot: Acrosin Antibody [NBP2-84388] - WB Suggested Anti-ACR Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

Applications for Acrosin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Acrosin

Acrosin is the major proteinase present in the acrosome of mature spermatozoa. It is a typical serine proteinase with trypsin-like specificity. It is stored in the acrosome in its precursor form, proacrosin. The active enzyme functions in the lysis of the zona pellucida, thus facilitating penetration of the sperm through the innermost glycoprotein layers of the ovum. The mRNA for proacrosin is synthesized only in the postmeiotic stages of spermatogenesis. In humans proacrosin first appears in the haploid spermatids.

Alternate Names

acrosin, ACRS, preproacrosin, proacrosin

Gene Symbol

ACR

Additional Acrosin Products

Product Documents for Acrosin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Acrosin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Acrosin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Acrosin Antibody - BSA Free and earn rewards!

Have you used Acrosin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies