ACSL6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84391

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ACSL6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACSL6. Peptide sequence: KCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTTGNPKGAMLT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ACSL6 Antibody - BSA Free

Western Blot: ACSL6 Antibody [NBP2-84391]

Western Blot: ACSL6 Antibody [NBP2-84391]

Western Blot: ACSL6 Antibody [NBP2-84391] - Host: Rabbit. Target Name: ACSL6. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for ACSL6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACSL6

Long-chain-fatty-acid--CoA ligase 6, or ACSL6, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in both the synthesis of cellular lipids and in beta-oxidation degradation. Like other isozymes of this family, ALCS6 converts free long-chain fatty acids into fatty acyl-CoA esters. Specifially, ACSL6 is critical for fatty acid metabolism in the brain and the acyl-CoAs produced may be utilized exclusively for the synthesis of the brain lipid.

ACSL6 is expressed predominantly in erythrocyte precursors, in particular in reticulocytes, fetal blood cells derived from fetal liver, hemopoietic stem cells from cord blood, bone marrow and brain.

Alternate Names

ACS2long-chain 6, acyl-CoA synthetase long-chain family member 6, EC 6.2.1, EC 6.2.1.3, FLJ16173, LACS 6, long fatty acyl-CoA synthetase 2, Long-chain acyl-CoA synthetase 6, long-chain-fatty-acid--CoA ligase 6

Gene Symbol

ACSL6

Additional ACSL6 Products

Product Documents for ACSL6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACSL6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACSL6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACSL6 Antibody - BSA Free and earn rewards!

Have you used ACSL6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies