ACSS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86949

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ACSS1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ACSS1. Peptide sequence: QHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ACSS1 Antibody - BSA Free

Western Blot: ACSS1 Antibody [NBP2-86949]

Western Blot: ACSS1 Antibody [NBP2-86949]

Western Blot: ACSS1 Antibody [NBP2-86949] - Host: Rabbit. Target Name: ACSS1. Sample Type: HCT15 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for ACSS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACSS1

An acetyl-CoA synthetase found in the mitochondrial matrix has been characterized in both cow and mouse. It is primarily a cardiac enzyme which produces acetyl-CoA mainly for the oxidation of acetate. The protein encoded by this gene is structurally similar to the cow and mouse proteins and therefore may serve a similar function in humans. [provided by RefSeq]

Alternate Names

ACAS2L, AceCS2, AceCS2L, Acetate--CoA ligase 2, Acetyl-CoA synthetase 2, acetyl-Coenzyme A synthetase 2 (AMP forming)-like, acetyl-coenzyme A synthetase 2-like, mitochondrial, acyl-CoA synthetase short-chain family member 1dJ568C11.3, EC 6.2.1, EC 6.2.1.1, FLJ45659, KIAA1846, MGC33843

Gene Symbol

ACSS1

Additional ACSS1 Products

Product Documents for ACSS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACSS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACSS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACSS1 Antibody - BSA Free and earn rewards!

Have you used ACSS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies