ACTR1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38278

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACTR1A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 187-376 of human ACTR1A (NP_005727.1).

Sequence:
GRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit ACTR1A Antibody - BSA Free (NBP3-38278) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ACTR1A Antibody - BSA Free

ACTR1A Antibody

Western Blot: ACTR1A Antibody [NBP3-38278] -

Western Blot: ACTR1A Antibody [NBP3-38278] - Western blot analysis of various lysates using ACTR1A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.

Applications for ACTR1A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ACTR1A

The actin-related protein ACTR1A, a member of the superfamily of actin-related proteins, is the major subunit of the dynactin complex, a key component of the cytoplasmic dynein motor machinery. The major components of the dynactin complex, consisting of at least ten polypeptides, include ACTR1A. ACTR1A, the most abundant subunit in the dynactin complex, is most similar to conventional actin (>50% amino acid identity). The dynactin complex has been shown to localize to multiple structures within the cell, including membrane organelles, the centrosome, spindle poles, and spindle pole microtubules during mitosis and prometaphase kinetochores. It regulates dyneinmediated vesicle movement on microtubules as well as spindle assembly and cell division. ACTR1A overexpression in cells results in aberrant spindle morphologies and cell cycle delay at prometaphase, suggesting a possible function of ACTR1A/dynactin complex in progression through the prometaphase of mitosis.

Alternate Names

Actin-RPV, alpha-centractin, ARP1 (actin-related protein 1, yeast) homolog A (centractin alpha), ARP1 actin-related protein 1 homolog A, centractin alpha (yeast), ARP1actin-RPV, centractin, Centrosome-associated actin homolog, CTRN1, FLJ52695, FLJ52800, FLJ55002

Gene Symbol

ACTR1A

Additional ACTR1A Products

Product Documents for ACTR1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACTR1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACTR1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACTR1A Antibody - BSA Free and earn rewards!

Have you used ACTR1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies