ACTR3B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56569

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACTR3B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ACTR3B(ARP3 actin-related protein 3 homolog B (yeast)) Antibody(against the N terminal of ACTR3B (NP_065178). Peptide sequence DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACTR3B Antibody - BSA Free

Western Blot: ACTR3B Antibody [NBP1-56569]

Western Blot: ACTR3B Antibody [NBP1-56569]

Western Blot: ACTR3B Antibody [NBP1-56569] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for ACTR3B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACTR3B

ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

Alternate Names

actin-related protein 3B, actin-related protein 3-beta, actin-related protein Arp11, Actin-related protein ARP4, ARP11Actin-like protein 3B, ARP3 actin-related protein 3 homolog B (yeast), ARP3beta, ARP3-beta, ARP4, DKFZp686O24114

Entrez Gene IDs

57180 (Human)

Gene Symbol

ACTR3B

UniProt

Q9P1U1 (Human)

Additional ACTR3B Products

Product Documents for ACTR3B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACTR3B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACTR3B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACTR3B Antibody - BSA Free and earn rewards!

Have you used ACTR3B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies