ADAM8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10837

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ADAM8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ADAM8 (NP_031429.1). Peptide sequence GQYPESLSYALGTSGHVFTLHLRKNRDLLGSSYTETYSAANGSEVTEQLQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

90 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ADAM8 Antibody - BSA Free

Western Blot: ADAM8 Antibody [NBP3-10837]

Western Blot: ADAM8 Antibody [NBP3-10837]

Western Blot: ADAM8 Antibody [NBP3-10837] - Western blot analysis of ADAM8 in Mouse Testis lysates. Antibody dilution at 1ug/ml

Applications for ADAM8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAM8

Members of ADAM family are cell surface proteins with a unique structure possessing both potential adhesion and protease domains. The extracellular region of ADAM8 shows significant amino acid sequence homology to hemorrhagic snake venom proteins, including the metalloprotease and disintegrin domains. The expression of ADAM8 is upregulated by retinoic acid and vitamin D3. ADAM8 is involved in protein processing at the cell surface and is also thought to act as a leukocyte differentiation marker.

Long Name

A Disintegrin and Metalloprotease-like Domain 8

Alternate Names

CD156a, MS2

Gene Symbol

ADAM8

Additional ADAM8 Products

Product Documents for ADAM8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ADAM8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for ADAM8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAM8 Antibody - BSA Free and earn rewards!

Have you used ADAM8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies