ADAMTS19 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69170

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ADAMTS19 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

100 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ADAMTS19 Antibody - BSA Free

Western Blot: ADAMTS19 Antibody [NBP1-69170]

Western Blot: ADAMTS19 Antibody [NBP1-69170]

Western Blot: ADAMTS19 Antibody [NBP1-69170] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.

Applications for ADAMTS19 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAMTS19

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS16, another family member.

Alternate Names

A disintegrin and metalloproteinase with thrombospondin motifs 19, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 19, ADAM metallopeptidase with thrombospondin type 1 motif, 19, ADAM-TS 19, ADAM-TS19, ADAMTS-19, EC 3.4.24.-, FLJ16042

Entrez Gene IDs

171019 (Human)

Gene Symbol

ADAMTS19

UniProt

Q8TE59 (Human)

Additional ADAMTS19 Products

Product Documents for ADAMTS19 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADAMTS19 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADAMTS19 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAMTS19 Antibody - BSA Free and earn rewards!

Have you used ADAMTS19 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies