ADAMTSL-1/Punctin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88763

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ADAMTSL-1/Punctin Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAMTSL-1/Punctin. Peptide sequence: STVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit ADAMTSL-1/Punctin Antibody - BSA Free (NBP2-88763) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ADAMTSL-1/Punctin Antibody - BSA Free

Western Blot: ADAMTSL-1/Punctin Antibody [NBP2-88763]

Western Blot: ADAMTSL-1/Punctin Antibody [NBP2-88763]

Western Blot: ADAMTSL-1/Punctin Antibody [NBP2-88763] - Host: Rabbit. Target Name: ADAMTSL1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for ADAMTSL-1/Punctin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAMTSL-1/Punctin

ADAMTSL1 encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq]

Long Name

ADAMTS-like Protein 1

Alternate Names

ADAMTSL1, Punctin-1

Gene Symbol

ADAMTSL1

Additional ADAMTSL-1/Punctin Products

Product Documents for ADAMTSL-1/Punctin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ADAMTSL-1/Punctin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for ADAMTSL-1/Punctin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAMTSL-1/Punctin Antibody - BSA Free and earn rewards!

Have you used ADAMTSL-1/Punctin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies