Adenosine A2b R Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68953

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Adenosine A2b R Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ADORA2B (adenosine A2b receptor) The peptide sequence was selected form the C terminal of ADORA2B. Peptide sequence AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Adenosine A2b R Antibody - BSA Free

Western Blot: Adenosine A2b R Antibody [NBP1-68953]

Western Blot: Adenosine A2b R Antibody [NBP1-68953]

Western Blot: Adenosine A2b R Antibody [NBP1-68953] - Human breast cancer cell lines SUM149 and SUM159 were exposed to either 20% or 1% of oxygen and the expression of ADORA2B was detected by Western blot. Image from verified customer review.
Western Blot: Adenosine A2b R Antibody [NBP1-68953]

Western Blot: Adenosine A2b R Antibody [NBP1-68953]

Western Blot: Adenosine A2b R Antibody [NBP1-68953] - Antibody at 0.2-1 ug/mL.

Applications for Adenosine A2b R Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Recommended positive control: 293T cell lysate.

Reviewed Applications

Read 1 review rated 4 using NBP1-68953 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenosine A2b R

This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17.

Long Name

Adenosine A2b Receptor

Alternate Names

Adenosine A2bR, ADORA2B

Gene Symbol

ADORA2B

OMIM

NP_000667 (Human)

UniProt

P29275 (Human)

Additional Adenosine A2b R Products

Product Documents for Adenosine A2b R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Adenosine A2b R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenosine A2b R Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Adenosine A2b R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Adenosine A2b R Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Human breast cancer cell lines
    Species: Human
    Verified Customer | Posted 12/02/2018
    Human breast cancer cell lines SUM149 and SUM159 were exposed to either 20% or 1% of oxygen and the expression of ADORA2B was detected through Western blot.
    Adenosine A2b R Antibody - BSA Free NBP1-68953

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies