Adenosine Deaminase/ADA Antibody (5R10B4)

Novus Biologicals | Catalog # NBP3-16575

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5R10B4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Adenosine Deaminase/ADA (NP_000013.2). NRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Adenosine Deaminase/ADA Antibody (5R10B4) (NBP3-16575) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Adenosine Deaminase/ADA Antibody (5R10B4)

Western Blot: Adenosine Deaminase/ADA Antibody (5R10B4) [NBP3-16575]

Western Blot: Adenosine Deaminase/ADA Antibody (5R10B4) [NBP3-16575]

Western Blot: Adenosine Deaminase/ADA Antibody (5R10B4) [NBP3-16575] - Western blot analysis of extracts of various cell lines, using Adenosine Deaminase (Adenosine Deaminase/ADA) Rabbit mAb (NBP3-16575) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
Adenosine Deaminase/ADA Antibody (5R10B4)

Western Blot: Adenosine Deaminase/ADA Antibody (5R10B4) [NBP3-16575] -

Western Blot: Adenosine Deaminase/ADA Antibody (5R10B4) [NBP3-16575] - Western blot analysis of various lysates, using Adenosine Deaminase/ADA Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Adenosine Deaminase/ADA Antibody (5R10B4)

Western Blot: Adenosine Deaminase/ADA Antibody (5R10B4) [NBP3-16575] -

Western Blot: Adenosine Deaminase/ADA Antibody (5R10B4) [NBP3-16575] - Western blot analysis of Mouse stomach, using Adenosine Deaminase/ADA Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 45s.

Applications for Adenosine Deaminase/ADA Antibody (5R10B4)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Adenosine Deaminase/ADA

Adenosine deaminase is an enzyme involved in purine metabolism. It is needed for the breakdown of adenosine from food and from the turnover of nucleic acids in tissues. It irreversibly deaminates adenosine, converting it to the related nucleoside inosine by the removal of an amine group. Inosine can then be deribosylated (removed from ribose) by another enzyme called purine nucleoside phosphorylase (PNP), converting it to hypoxanthine. Mutations in the gene for adenosine deaminase causing it to not be expressed are one cause of severe combined immunodeficiency (SCID). Mutations causing it to be overexpressed are one cause of hemolytic anemia. There is some evidence that a different allelle (ADA2) may lead to autism. There are 2 isoforms of ADA: ADA1 and ADA2. ADA1 is found in most body cells, particularly lymphocytes and macrophages, where it is present not only in the cytosol but also as the ecto- form on the cell membrane attached to a protein called CD26. ADA2 has only been found in the macrophage where it co-exists with ADA1 where the two isoforms regulate the ratio of adenosine to deoxyadenosine to potentiate the killing of parasites. ADA2 is the predominant form present in human plasma and is increased in many diseases, particularly those associated with the immune system: for example rheumatoid arthritis, psoriasis and sarcoidosis. The plasma AD2 isoform is also increased in most cancers.

Long Name

Adenosine Aminohydrolase

Alternate Names

ADA, ADA1

Gene Symbol

ADA

Additional Adenosine Deaminase/ADA Products

Product Documents for Adenosine Deaminase/ADA Antibody (5R10B4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adenosine Deaminase/ADA Antibody (5R10B4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenosine Deaminase/ADA Antibody (5R10B4)

There are currently no reviews for this product. Be the first to review Adenosine Deaminase/ADA Antibody (5R10B4) and earn rewards!

Have you used Adenosine Deaminase/ADA Antibody (5R10B4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...