Adipolin/FAM132A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82569

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Adipolin/FAM132A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM132A. Peptide sequence: MRRWAWAAVVVLLGPQLVLLGGVGARREAQRTQQPGQRADPPNATASASS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit Adipolin/FAM132A Antibody - BSA Free (NBP2-82569) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Adipolin/FAM132A Antibody - BSA Free

Western Blot: Adipolin/FAM132A Antibody [NBP2-82569]

Western Blot: Adipolin/FAM132A Antibody [NBP2-82569]

Western Blot: Adipolin/FAM132A Antibody [NBP2-82569] - Host: Rabbit. Target Name: FAM132A. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Adipolin/FAM132A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adipolin/FAM132A

C1qTNF proteins constitute a highly conserved family of Acrp30/Adiponectin paralogs that share a modular organization comprising an N-terminal signal peptide, a short variable region, a collagenous domain and a C-terminal globular domain. C1qTNF proteins are predicted to have trimeric structures that assemble into hexameric and higher order molecular forms. C1qTNF3, also known as CORS26, is predominantly expressed in cartilage and is induced in mature adipocytes. C1qTNF10, also known as C1qL2, is a protein that shows 28% - 30% sequence identity with C1q subunits A, B, and C. It is predicted to contain one collagen-like and C1q domain. Mouse and human C1qTNF10 share over 90% amino acid sequence identity.

Long Name

Family with Sequence Similarity 132, Member A

Alternate Names

Adipose-Derived Insulin-Sensitizing Factor, C1qDC2, C1qTNF12, CTRP12, FAM132A

Gene Symbol

FAM132A

Additional Adipolin/FAM132A Products

Product Documents for Adipolin/FAM132A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adipolin/FAM132A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Complement Pathway

Customer Reviews for Adipolin/FAM132A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adipolin/FAM132A Antibody - BSA Free and earn rewards!

Have you used Adipolin/FAM132A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies