Advillin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91606

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Advillin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards Advillin. Peptide sequence SGERLXXXXXXKAMLLAKDIRDREGGGRAEIGVIEGDKEAASPELMTVLQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Advillin Antibody - BSA Free

Western Blot: Advillin Antibody [NBP1-91606]

Western Blot: Advillin Antibody [NBP1-91606]

Western Blot: Advillin Antibody [NBP1-91606] - Titration: 1.0 ug/ml Positive Control: Rat Muscle.

Applications for Advillin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Advillin

Advillin, also known as AVIL, contains two isoforms that are 92 kDa and 91 kDa, and is involved in the development of ganglia and the regeneration and remodeling of axons after a peripheral injury occurs. Current research is being conducted on this calcium regulated actin-binding protein to determine its relation with a variety of diseases and disorders, including petit mal status, prostatitis, inflammatory bowel disease, neuronitis, dengue hemorrhagic fever, dacryoadenitis, and dengue shock syndrome. Advillin has been linked to stress response, cytoskeleton organization, and nervous system development, through which it interacts with proteins CRK and HDAC8.

Alternate Names

ADVIL, advillin, DOC6, FLJ12386, MGC133244, p92DKFZp779O1812

Gene Symbol

AVIL

UniProt

NP_077377 (Rat)

Additional Advillin Products

Product Documents for Advillin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Advillin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Advillin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Advillin Antibody - BSA Free and earn rewards!

Have you used Advillin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies