AFG3L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59572

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AFG3L2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to AFG3L2 (AFG3 ATPase family gene 3-like 2 (yeast) The peptide sequence was selected from the middle region of AFG3L2. Peptide sequence VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AFG3L2 Antibody - BSA Free

Western Blot: AFG3L2 Antibody [NBP1-59572]

Western Blot: AFG3L2 Antibody [NBP1-59572]

Western Blot: AFG3L2 Antibody [NBP1-59572] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for AFG3L2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AFG3L2

AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.

Alternate Names

AFG3 (ATPase family gene 3, yeast)-like 2, AFG3 ATPase family gene 3-like 2 (S. cerevisiae), AFG3 ATPase family gene 3-like 2 (yeast), AFG3-like protein 2, ATPase family gene 3, yeast, EC 3.4.24, EC 3.4.24.-, FLJ25993, Paraplegin-like protein, SCA28, spinocerebellar ataxia 28

Gene Symbol

AFG3L2

UniProt

Q9Y4W6 (Human)

Additional AFG3L2 Products

Product Documents for AFG3L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AFG3L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AFG3L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AFG3L2 Antibody - BSA Free and earn rewards!

Have you used AFG3L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies