AGO1/EIF2C1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56530

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AGO1/EIF2C1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EIF2C1(eukaryotic translation initiation factor 2C, 1) The peptide sequence was selected from the N terminal of EIF2C1. Peptide sequence MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AGO1/EIF2C1 Antibody - BSA Free

Western Blot: AGO1/EIF2C1 Antibody [NBP1-56530]

Western Blot: AGO1/EIF2C1 Antibody [NBP1-56530]

Western Blot: AGO1/EIF2C1 Antibody [NBP1-56530] - THP-1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: AGO1/EIF2C1 Antibody [NBP1-56530]

Western Blot: AGO1/EIF2C1 Antibody [NBP1-56530]

Western Blot: AGO1/EIF2C1 Antibody [NBP1-56530] - Jurkat, Antibody Dilution: 1.0 ug/ml AGO1 is supported by BioGPS gene expression data to be expressed in Jurkat.

Applications for AGO1/EIF2C1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AGO1/EIF2C1

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-me

Alternate Names

AGO1Q99, argonaute 1, Argonaute1, DKFZp686M13167, EIF2C, eIF2C 1, eIF-2C 1, Eukaryotic translation initiation factor 2C 1, eukaryotic translation initiation factor 2C, 1, GERP95, Golgi Endoplasmic Reticulum protein 95 kDa, hAgo1, protein argonaute-1, Putative RNA-binding protein Q99

Gene Symbol

AGO1

UniProt

Q9UL18 (Human)

Additional AGO1/EIF2C1 Products

Product Documents for AGO1/EIF2C1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AGO1/EIF2C1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for AGO1/EIF2C1 Antibody - BSA Free

Customer Reviews for AGO1/EIF2C1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AGO1/EIF2C1 Antibody - BSA Free and earn rewards!

Have you used AGO1/EIF2C1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies