AKAP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84413

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all AKAP3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AKAP3. Peptide sequence: PGSGDRVSGSSQSPPNLKYKSTLKIKESTKERQGPDDKPPSKKSFFYKEV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for AKAP3 Antibody - BSA Free

Western Blot: AKAP3 Antibody [NBP2-84413]

Western Blot: AKAP3 Antibody [NBP2-84413]

Western Blot: AKAP3 Antibody [NBP2-84413] - Host: Rabbit. Target Name: AKAP3. Sample Tissue: Human COLO205 Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for AKAP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AKAP3

A-kinase anchor proteins (AKAPs) direct the activity of protein kinase A (PKA) by tethering the enzyme near its physiologic substrates. May function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction in sperm.

Alternate Names

A kinase (PRKA) anchor protein 3, AKAP110AKAP 110, AKAP-3, A-kinase anchor protein 110 kDa, Cancer/testis antigen 82, CT82A-kinase anchor protein 3, Fibrous sheath protein of 95 kDa, fibrousheathin 1, Fibrousheathin I, fibrousheathin-1, FSP95A-kinase anchor protein, 110kDa, PRKA3, protein kinase A anchoring protein 3, Protein kinase A-anchoring protein 3, SOB1fibrous sheath protein, 95kDa, Sperm oocyte-binding protein, sperm oocyte-binding protein 1

Gene Symbol

AKAP3

Additional AKAP3 Products

Product Documents for AKAP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AKAP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AKAP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AKAP3 Antibody - BSA Free and earn rewards!

Have you used AKAP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies