Akirin2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10695

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Akirin2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Akirin2 (NP_001007590). Peptide sequence CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Akirin2 Antibody - BSA Free

Western Blot: Akirin2 Antibody [NBP3-10695]

Western Blot: Akirin2 Antibody [NBP3-10695]

Western Blot: Akirin2 Antibody [NBP3-10695] - Western blot analysis of Akirin2 in Mouse Spleen lysates. Antibody dilution at 1.0ug/ml

Applications for Akirin2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Akirin2

Akirin2 is required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to represstranscription of DUSP1

Alternate Names

akirin 2, akirin-2, C6orf166, chromosome 6 open reading frame 166, dJ486L4.2, FBI1, FLJ10342, fourteen-three-three beta interactant 1

Gene Symbol

AKIRIN2

Additional Akirin2 Products

Product Documents for Akirin2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Akirin2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Akirin2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Akirin2 Antibody - BSA Free and earn rewards!

Have you used Akirin2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies