ALDH3B2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04930

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ALDH3B2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 296-385 of human ALDH3B2 (NP_000686.2). MLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ALDH3B2 Antibody - Azide and BSA Free

Western Blot: ALDH3B2 AntibodyAzide and BSA Free [NBP3-04930]

Western Blot: ALDH3B2 AntibodyAzide and BSA Free [NBP3-04930]

Western Blot: ALDH3B2 Antibody [NBP3-04930] - Western blot analysis of extracts of various cell lines, using ALDH3B2 antibody (NBP3-04930) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for ALDH3B2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ALDH3B2

The ALDH3B2 gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in thedetoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular familymember is over 10 k

Alternate Names

acetaldehyde dehydrogenase 8, aldehyde dehydrogenase 3 family, member B2, Aldehyde dehydrogenase 8, ALDH8aldehyde dehydrogenase family 3 member B2, EC 1.2.1, EC 1.2.1.5

Gene Symbol

ALDH3B2

Additional ALDH3B2 Products

Product Documents for ALDH3B2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ALDH3B2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ALDH3B2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ALDH3B2 Antibody - Azide and BSA Free and earn rewards!

Have you used ALDH3B2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies