ALDH8A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84418

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ALDH8A1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ALDH8A1. Peptide sequence: KKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit ALDH8A1 Antibody - BSA Free (NBP2-84418) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ALDH8A1 Antibody - BSA Free

Western Blot: ALDH8A1 Antibody [NBP2-84418]

Western Blot: ALDH8A1 Antibody [NBP2-84418]

Western Blot: ALDH8A1 Antibody [NBP2-84418] - Host: Rabbit. Target Name: ALDH8A1. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for ALDH8A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALDH8A1

ALDH8A1 belongs to the aldehyde dehydrogenases family of proteins. It plays a role in a pathway of 9-cis-retinoic acid biosynthesis in vivo. This enzyme converts 9-cis-retinal into the retinoid X receptor ligand 9-cis-retinoic acid, and has approximately 40-fold higher activity with 9-cis-retinal than with all-trans-retinal. Therefore, it is the first known aldehyde dehydrogenase to show a preference for 9-cis-retinal relative to all-trans-retinal. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Alternate Names

Aldehyde dehydrogenase 12, aldehyde dehydrogenase 8 family, member A1, aldehyde dehydrogenase family protein, ALDH12aldehyde dehydrogenase family 8 member A1, DJ352A20.2, DKFZp779D2315, EC 1.2.1, EC 1.2.1.-, EC 1.2.1.3, MGC138650

Gene Symbol

ALDH8A1

Additional ALDH8A1 Products

Product Documents for ALDH8A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ALDH8A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALDH8A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALDH8A1 Antibody - BSA Free and earn rewards!

Have you used ALDH8A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies