ALG13 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92394

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ALG13 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-167 of human ALG13 (NP_001311219.1). VVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ALG13 Antibody - Azide and BSA Free

Western Blot: ALG13 AntibodyAzide and BSA Free [NBP2-92394]

Western Blot: ALG13 AntibodyAzide and BSA Free [NBP2-92394]

Western Blot: ALG13 Antibody [NBP2-92394] - Western blot analysis of extracts of various cell lines, using ALG13 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for ALG13 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ALG13

The protein encoded by the ALG13 gene is a subunit of a bipartite UDP-N-acetylglucosamine transferase. It heterodimerizeswith asparagine-linked glycosylation 14 homolog to form a functional UDP-GlcNAc glycosyltransferase that catalyzes thesecond sugar addition of the highly conserved oligosaccharide precursor in endoplasmic reticulum N-linkedglycosylation. Multiple transcript variants encoding different isoforms have been found for this gene. (provided byRefSeq)

Alternate Names

Asparagine-linked glycosylation 13 homolog, asparagine-linked glycosylation 13 homolog (S. cerevisiae), chromosome X open reading frame 45, CXorf45, EC 2.4.1.141, FLJ23018, FLJ31785, GLT28D1, glycosyltransferase 28 domain containing 1, Glycosyltransferase 28 domain-containing protein 1, hematopoietic stem/progenitor cells protein MDS031, MDS031, MGC12423, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, YGL047W

Gene Symbol

ALG13

Additional ALG13 Products

Product Documents for ALG13 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ALG13 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ALG13 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ALG13 Antibody - Azide and BSA Free and earn rewards!

Have you used ALG13 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies