alpha-L-Iduronidase, encoded by the IDUA gene, is an important enzyme required for the lysosomal degradation of glycosaminoglycans (GAGs). It hydrolyzes the non-reducing terminal a-L-iduronic acid residues in GAGs, including dermatan sulfate and heparan sulfate. Mutations in IDUA that result in enzymatic deficiency lead to the autosomal recessive disease mucopolysaccharidosis type I (MPS I). MPS I causes progressive cellular, tissue, and organ damage.
alpha-L-Iduronidase/IDUA Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-10781
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human alpha-L-Iduronidase/IDUA. Peptide sequence LAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRL
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit alpha-L-Iduronidase/IDUA Antibody - BSA Free (NBP3-10781) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for alpha-L-Iduronidase/IDUA Antibody - BSA Free
Western Blot: alpha-L-Iduronidase/IDUA Antibody [NBP3-10781]
Western Blot: alpha-L-Iduronidase/IDUA Antibody [NBP3-10781] - Western blot analysis of alpha-L-Iduronidase/IDUA in 293T Whole Cell lysates. Antibody dilution at 1.0ug/mlApplications for alpha-L-Iduronidase/IDUA Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: alpha-L-Iduronidase/IDUA
Alternate Names
alphaLIduronidase, IDA, IDUA
Gene Symbol
IDUA
Additional alpha-L-Iduronidase/IDUA Products
Product Documents for alpha-L-Iduronidase/IDUA Antibody - BSA Free
Product Specific Notices for alpha-L-Iduronidase/IDUA Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for alpha-L-Iduronidase/IDUA Antibody - BSA Free
There are currently no reviews for this product. Be the first to review alpha-L-Iduronidase/IDUA Antibody - BSA Free and earn rewards!
Have you used alpha-L-Iduronidase/IDUA Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...