Associated Molecule with the SH3 Domain of STAM (AMSH), also known as STAM Binding Protein (STAMBP), is a 424 amino acid (aa) zinc metalloprotease member of the peptidase M67C class of enzymes with a predicted molecular weight of 50 kDa. The mouse and rat AMSH/STAMBP orthologs share 83% and 84% aa sequence identity with the human protein, respectively. AMSH/STAMBP is ubiquitously expressed and functions at endosomes where it opposes Ubiquitin-dependent sorting and recycling of receptors to lysosomes. The ability of AMSH/STAMBP to cleave K63-linked, but not K48-linked, poly-Ubiquitin chains is mediated by a JAMM motif (aa 335-348). Receptor substrates for AMSH/STAMBP include EGF R and Erb2. AMSH/STAMBP also functions in cytokine signaling and participates in cMyc induction by IL-2 or GM-CSF, as well as bone morphogenic protein (BMP) signaling via inhibition of Smad proteins. AMSH/STAMBP knockout mice show early-onset neurodegeneration and increased protein deposits in the brain, suggesting that AMSH/STAMBP may contribute to neurodegenerative diseases such as Alzheimer’s Disease, ALS, or Parkinson’s Disease.
AMSH/STAMBP Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP1-90172PEP
Key Product Details
Source
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: QQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQP
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP1-90172PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: AMSH/STAMBP
Long Name
Alternate Names
Gene Symbol
Additional AMSH/STAMBP Products
Product Documents for AMSH/STAMBP Recombinant Protein Antigen
Product Specific Notices for AMSH/STAMBP Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for AMSH/STAMBP Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review AMSH/STAMBP Recombinant Protein Antigen and earn rewards!
Have you used AMSH/STAMBP Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review