ANKH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59748

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ANKH Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ANKH(ankylosis, progressive homolog (mouse)) The peptide sequence was selected from the N terminal of ANKH (NP_473368). Peptide sequence SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ANKH Antibody - BSA Free

Western Blot: ANKH Antibody [NBP1-59748]

Western Blot: ANKH Antibody [NBP1-59748]

Western Blot: ANKH Antibody [NBP1-59748] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.

Applications for ANKH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ANKH

ANKH regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.This gene encodes a multipass transmembrane protein that is expressed in joints and other tissues and controls pyrophosphate levels in cultured cells. Progressive ankylosis-mediated control of pyrophosphate levels has been suggested as a possible mechanism regulating tissue calcification and susceptibility to arthritis in higher animals. Mutations in this gene have been associated with autosomal dominant craniometaphyseal dysplasia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

ANKcraniometaphyseal dysplasia, Jackson type (dominant), ankylosis, progressive (mouse) homolog, ankylosis, progressive homolog (mouse), CCAL2, CMDJ, CPPDDFLJ27166, HANKMANK, KIAA1581, progressive ankylosis protein homolog

Entrez Gene IDs

56172 (Human)

Gene Symbol

ANKH

UniProt

Q9HCJ1 (Human)

Additional ANKH Products

Product Documents for ANKH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ANKH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ANKH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ANKH Antibody - BSA Free and earn rewards!

Have you used ANKH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies