ANKRD1 Antibody (6C3I2)

Novus Biologicals | Catalog # NBP3-33330

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6C3I2
View all ANKRD1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human ANKRD1 (NP_055206.2).

Sequence:
MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit ANKRD1 Antibody (6C3I2) (NBP3-33330) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ANKRD1 Antibody (6C3I2)

ANKRD1 Antibody (6C3I2)

Western Blot: ANKRD1 Antibody (6C3I2) [NBP3-33330] -

Western Blot: ANKRD1 Antibody (6C3I2) [NBP3-33330] - Analysis of various lysates using ANKRD1 Rabbit mAb at 1:2000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 45s.

Applications for ANKRD1 Antibody (6C3I2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:2500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ANKRD1

ANKRD1 is encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system. [provided by RefSeq]

Alternate Names

ALRP, ankyrin repeat domain 1 (cardiac muscle), ankyrin repeat domain-containing protein 1, bA320F15.2, C193, C-193, Cardiac ankyrin repeat protein, CARPCytokine-inducible nuclear protein, CVARP, Cytokine-inducible gene C-193 protein, HA1A2, liver ankyrin repeat domain 1, MCARP

Gene Symbol

ANKRD1

Additional ANKRD1 Products

Product Documents for ANKRD1 Antibody (6C3I2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ANKRD1 Antibody (6C3I2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ANKRD1 Antibody (6C3I2)

There are currently no reviews for this product. Be the first to review ANKRD1 Antibody (6C3I2) and earn rewards!

Have you used ANKRD1 Antibody (6C3I2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies