ANKRD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87001

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ANKRD2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKRD2. Peptide sequence: MMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ANKRD2 Antibody - BSA Free

Western Blot: ANKRD2 Antibody [NBP2-87001]

Western Blot: ANKRD2 Antibody [NBP2-87001]

Western Blot: ANKRD2 Antibody [NBP2-87001] - Host: Rabbit. Target Name: ANKRD2. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Applications for ANKRD2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ANKRD2

ANKRD2 belongs to the conserved muscle ankyrin repeat protein (MARP) family. Expression of MARPs is induced in response to physiologic stress, injury, and hypertrophy (Miller et al., 2003 [PubMed 14583192]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

ankyrin repeat domain 2 (stretch responsive muscle), ankyrin repeat domain-containing protein 2, ankyrin-repeat protein, ARPPSkeletal muscle ankyrin repeat protein, hArpp, MGC104314

Gene Symbol

ANKRD2

Additional ANKRD2 Products

Product Documents for ANKRD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ANKRD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ANKRD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ANKRD2 Antibody - BSA Free and earn rewards!

Have you used ANKRD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies